PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10028473
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 225aa    MW: 25657.4 Da    PI: 9.9529
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10028473genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF50.92e-164190150
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                 k+i+ ++   vtfskRr gi KKA+EL +L++ e+a +++s+ g+ ++++
  Lus10028473 41 KKIKKDTDMMVTFSKRRFGIYKKASELVTLTGSEIAFLVYSPAGNAFTFA 90
                 67999999****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.5E-223392IPR002100Transcription factor, MADS-box
PROSITE profilePS5006621.7683393IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-2134121IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-143555IPR002100Transcription factor, MADS-box
PfamPF003194.0E-184289IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-145570IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-147091IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MEFPTVNIYD DVSSSSEDNI DITNIHPVPK KTRGRRKIQM KKIKKDTDMM VTFSKRRFGI  60
YKKASELVTL TGSEIAFLVY SPAGNAFTFA HPSFDFLVTK YLGIQHLDPS IISYETIYVL  120
QQDRINELTV RYTNSLKNLE NEQRKEKDLS ARCHGKSLNN WWNIGFKKDM IHLHRARPAL  180
PKNHTCLSCR LLLVGKTSRP APTVSSTLQP PSNPPYQHYD PGDS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.13e-27AGAMOUS-like 62